PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022166.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GATA
Protein Properties Length: 542aa    MW: 59978.3 Da    PI: 7.0321
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022166.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.84.5e-16741135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Pbr022166.2  7 CYHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGT 41
                 ****************55555***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.9E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-11546No hitNo description
CDDcd002026.02E-17654No hitNo description
PROSITE profilePS5011411.345740IPR000679Zinc finger, GATA-type
PfamPF003207.0E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF139191.4E-10285377IPR028020ASX homology domain
PfamPF165509.1E-9300366IPR032368UCH-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPDKPVLCN ACGSRWRTKG TLVNYTPLHA RAEPDDYEDH  60
RVSRVKSISV NKNKEIKLVK RKQNPESVVA GGVNSDYSHG FRKLTEEDTS NRSSSGSAVS  120
NSESCAQFGS GDASDLTGPA QSMVWDSMVP SRKRTCVGRP KPSPVEKLTK DLYTILHEQQ  180
SSYFSGSSEE DLLFESETPM VSVEIGHGSV LIRHPNSIAR EEESEASSIS VDNKQCHANE  240
AYSHSATLFV HNNNKGVNMA STVSGRMNNL SGQGMQHEPM KREKSQLDNL QILGNHNSPL  300
CHVDLNDILN VEEFTRQLTN EEQQQLLKHL PPVDAVKFPY SLKSMFDSPQ FIENLTSFQQ  360
LLAEGVFDIS FPGAKTEDCK TLKRLALSNS SKSKWVERYH LLKKYKTSYG KSIVSAPNMA  420
SSNFRHVKRL QDNETQSLPD VKMMKSPKRI IMKGSYENKD LMDYDGGSCF SPKSLFALPP  480
DGSSFLMDSM NFVDESSDQD LLLDVPSNGS FAQAELLHPA MSFGAPQATS SSSIYPHLLH  540
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378398.10.0PREDICTED: GATA transcription factor 26-like
RefseqXP_009378399.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-163GAT26_ARATH; GATA transcription factor 26
TrEMBLD9ZIZ50.0D9ZIZ5_MALDO; GATA domain class transcription factor
STRINGPOPTR_0003s08080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-161GATA transcription factor 26